PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 573aa    MW: 64862.8 Da    PI: 7.667
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-24246PU_refplantGDBView CDS
gnl|UG|Lsa#S58680223PU_unrefUnigeneView CDS
gnl|UG|Lsa#S58691329PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.62.2e-11298340246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
        Lsa013919 298 GGFSEEEDNTICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 340
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.120.4208.4E-5135IPR027363Methylthioribose-1-phosphate isomerase-like, N-terminal domain
PfamPF010082.6E-262127IPR000649Initiation factor 2B-related
SuperFamilySSF1009502.85E-392127No hitNo description
Gene3DG3DSA:3.40.50.104701.5E-2836127No hitNo description
PROSITE profilePS500905.39271291IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-11273304IPR009057Homeodomain-like
SuperFamilySSF466895.13E-20277346IPR009057Homeodomain-like
PROSITE profilePS5129421.092292346IPR017930Myb domain
SMARTSM007171.5E-10296344IPR001005SANT/Myb domain
PfamPF002493.2E-10298340IPR001005SANT/Myb domain
CDDcd001674.71E-7300342No hitNo description
Gene3DG3DSA:1.10.10.601.0E-17305343IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044237Biological Processcellular metabolic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MLEDDVASNK AIGSYGSSFI QIQQKESKKF PVLTHCNTAS LATAEFGTAL GVIRALHDDR  60
VLGRAYCTET RPFNQGSRLT AYKLVHDKIP ATLIGDYAAA ALMKTRSIHA IIVGADRVTA  120
NGDTAKKXEF LIVLLHKKGV KEKLKKQIKE VELAQSKEVS LHWYGMAESV QVIGGIYVSF  180
SHLGEIRTFG MLHSRFKWVT SALCEXPCAN AKKRSLKDIM EIIAQDVMND GPSGEALFAF  240
DYQESAINVP RNLKYHLIYE NIKSPNXSVT WSHIGIKRCG KSCRLRWLNY LRPNIKHGGF  300
SEEEDNTICS LYISIGSRWS IIAAQLPGRT DNDIKNYWNT RLKKKLLGRR KQSHGNKLDG  360
STQDSKNGNE MESLSNSAIE RLQLHMQLQN LENPNHSPNL AMWPFKLNPI QEKMMHRLQL  420
LSESSNPLMM QYALPDAHQK DELFRPYNNM YSLPNNMLMN QMENSIDGIN VPESSSQVQE  480
SVVMKQPGME FQQYWALQAE IDEFLSNKGA NSIQVDQAQA NEFDYFKEMD GSKDMMTWWS  540
NEFDANSASS NSWDSNGVLD HQQQGYEQSA LKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldq_A5e-381127132259Methylthioribose-1-phosphate isomerase
4ldq_B5e-381127132259Methylthioribose-1-phosphate isomerase
4ldr_A5e-381127132259Methylthioribose-1-phosphate isomerase
4ldr_B5e-381127132259Methylthioribose-1-phosphate isomerase
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007224828.16e-95hypothetical protein PRUPE_ppa023431mg
TrEMBLA0A068U3621e-103A0A068U362_COFCA; Uncharacterized protein
STRINGPOPTR_0018s10390.17e-91(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-50myb domain protein 36